DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG18180

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:218 Identity:54/218 - (24%)
Similarity:92/218 - (42%) Gaps:29/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LHTDGS---IFCAGTLITDVFILTAASCIRPNAVKVRLGE----FGRYPNELPEDHLVHYFLMYR 106
            :.||||   ...|||:|.:.:|||||.|:..:.|::..|.    .|.|...:..|:    |:.:.
  Fly    55 IRTDGSNSGAVGAGTIIANDWILTAAHCLTGDYVEIHYGSNWGWNGAYRQTVRRDN----FISHP 115

  Fly   107 LFNNESLANNIGLLKLTKRVQITDYIMPVCI-VLNPQNQQLSTMRFIGNAWMEDSNVSLTKELRP 170
            .:.::. ..:|||:: |..|.....|..:.: .:|.||.:......:...|....|.:|...|:.
  Fly   116 DWPSQG-GRDIGLIR-TPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNGNLADWLQC 178

  Fly   171 IVIQ----SKPKMCTNLDLYTQFCAGHQGNLRSCDGLTGSALI--QNSRYMNKYRHIQFGIATVN 229
            :.:|    |:.:........|..|..|......|.|.:|..|:  .|:|.:        |:.|..
  Fly   179 VDVQIISNSECEQAYGSVASTDMCTRHADGKSVCGGDSGGPLVTHDNARLV--------GVITFA 235

  Fly   230 DMDCEES-QGYTDVLKFYWWIQD 251
            .:.|.:. .|||.|..:..||:|
  Fly   236 SVSCHDGPSGYTRVSDYLEWIRD 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 54/218 (25%)
Tryp_SPc 44..249 CDD:214473 51/214 (24%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 51/214 (24%)
Tryp_SPc 36..259 CDD:238113 54/218 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.