DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG18179

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:244 Identity:63/244 - (25%)
Similarity:97/244 - (39%) Gaps:59/244 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LLHTDGS---IFCAGTLITDVFILTAASCIRPNAVKVRLGE----FGRYPNELPEDHLVHYFLMY 105
            |:.||||   ...|||:|...:|||||.|:..:.|::..|.    .|.:...:..|:    |:.:
  Fly    58 LIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGSNWGWNGAFRQSVRRDN----FISH 118

  Fly   106 RLFNNESLANNIGLLKLTKRVQITDYIMPVCIVLNPQNQQLSTMRFI--------------GNA- 155
            ..:..|. ..:|||:: |..|..||.|..|.:   |...:.|. ||:              ||. 
  Fly   119 PNWPAEG-GRDIGLIR-TPSVGFTDLINKVAL---PSFSEESD-RFVDTWCVACGWGGMDNGNLA 177

  Fly   156 -WMEDSNVSLTKELRPIVIQSKPKMCTNLDLYTQFCAGHQGNLRSCDGLTGSALI--QNSRYMNK 217
             |::..:|.       |:..|:.:........|..|........||.|.:|..|:  .|:|.:  
  Fly   178 DWLQCMDVQ-------IISNSECEQSYGTVASTDMCTRRTDGKSSCGGDSGGPLVTHDNARLV-- 233

  Fly   218 YRHIQFGIATVNDMDCEES-QGYTDVLKFYWWIQDVVSLFNHYSTNESY 265
                  |:.|...:||... .|||.|..:..||:|        :|..||
  Fly   234 ------GVITFGSVDCHSGPSGYTRVTDYLGWIRD--------NTGISY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 59/229 (26%)
Tryp_SPc 44..249 CDD:214473 57/226 (25%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 57/226 (25%)
Tryp_SPc 40..263 CDD:238113 60/237 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435872
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.