DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG33465

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:249 Identity:72/249 - (28%)
Similarity:118/249 - (47%) Gaps:17/249 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 STSLGPWTALLHTDGSIFCAGTLITDVFILTAASCI-RPNAVKVRLGEFGRYPNELP----EDHL 98
            :|...||.|.::.:....|.|||:..:|:||||||| :.:.:.|..|.:.:|.:...    |.:.
  Fly    41 ATETAPWMASIYKNNQFICDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYG 105

  Fly    99 VHYFLMYRLFNNESLANNIGLLKLTKRVQITDYIMPVCIVLNPQNQQLSTMRFIGNAWMEDSNVS 163
            |...|.:..|...:..|:||||:|...|....:|.|:||:|:...:.....||.|..|.:....:
  Fly   106 VAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQGTEA 170

  Fly   164 LTKELRPIVI-QSKPKMC-TNLDLYT----QFCAGHQGNLRS-CDGLTGSALIQNSRYMNKYRHI 221
            .::..:.:.: |.||..| .|..|..    |||||::.  || |...:||.|..:..|..|...:
  Fly   171 SSQVRQTVYLSQKKPFECHRNGQLLPINEGQFCAGNRD--RSFCRSNSGSPLTADFTYGVKNITV 233

  Fly   222 QFGIATVNDMDCEESQGYTDVLKFYWWIQDVVSLFNHYSTNESYIVNDYIKKNF 275
            |.|:.:.....|..:..||||:.|..||.:.|   .::.|....:|.:..:.|:
  Fly   234 QVGLVSYGSELCSPTSVYTDVVAFKDWIYNTV---RNFETKGDQVVYEECRSNW 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 67/219 (31%)
Tryp_SPc 44..249 CDD:214473 65/216 (30%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 67/219 (31%)
Tryp_SPc 46..261 CDD:214473 65/216 (30%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463383
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.