DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG6592

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:247 Identity:55/247 - (22%)
Similarity:106/247 - (42%) Gaps:38/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GSIFCAGTLITDVFILTAASCI----------RPNAVKVRLGEFGRYPNELPEDHLVHYFLMYRL 107
            |..:|.|:||:|..::|||.|:          ..|.:| ...|.|:....:|.::    |.:|..
  Fly   147 GLYWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIK-NAKEKGQVRLMVPSEN----FQIYPT 206

  Fly   108 FNNESLANNIGLLKLTKRVQITDYIMPVCIVLNPQN----QQLSTMRFIGNAWMEDSN--VSLTK 166
            :|.:.|.::|.:::|...|...:.|.|:.:   |:.    :.......|.:.|...:.  .:::.
  Fly   207 WNPKRLKDDIAIVRLPHAVSFNERIHPIQL---PKRHYEYRSFKNKLAIASGWGRYATGVHAISN 268

  Fly   167 ELRPIVIQ-SKPKMC-TNLDLY---TQFCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIA 226
            .||.:.:| ...:.| :|..|.   |..|...:....:|:|.:|..|:...|:..|  .:..||.
  Fly   269 VLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNARSTCNGDSGGPLVLQRRHSKK--RVLVGIT 331

  Fly   227 TVNDM-DCEESQGY----TDVLKFYWWIQDVVSLFNHYSTNESYIVNDYIKK 273
            :...: .|:  :||    |.|..:..||.|...:..|..|.|:...:.|:::
  Fly   332 SFGSIYGCD--RGYPAAFTKVASYLDWISDETGVSAHQDTTEAIFFDQYVRE 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 50/224 (22%)
Tryp_SPc 44..249 CDD:214473 48/221 (22%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 48/221 (22%)
Tryp_SPc 123..359 CDD:238113 50/223 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436433
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.