DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:260 Identity:60/260 - (23%)
Similarity:105/260 - (40%) Gaps:46/260 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SVSANYLYEQCGLMREEFSTSLGPWTALLHTDGSIFCAGTLITDVFILTAASCIR-PNAVKVRLG 84
            :.|..:.| |.||   .|:::.|.|          :|.|::|.:.::||||.|.. .:||.:..|
  Fly    46 ATSGQFPY-QVGL---SFASTSGSW----------WCGGSIIDNTWVLTAAHCTSGASAVTIYYG 96

  Fly    85 EFGRYPNELPEDHLVHYFLMYRLFNNESLANNIGLLKLTKRVQITDYIMPVCI-VLNPQNQQLST 148
            ...|...:|.:......|:.:..:|:..|.|:|.|:| |..|..|..|..|.: .:.......:.
  Fly    97 ATVRTSAQLVQTVSADNFVQHASYNSIVLRNDISLIK-TPTVAFTALINKVELPAIAGTYSTYTG 160

  Fly   149 MRFIGNAW--MEDSNVSLTKELRPIVIQ-SKPKMCTN-----LDLYTQFCAGHQGNLRSCDGLTG 205
            .:.|.:.|  ..||..|:...|:..|.: .....|.|     :......|......:.:|:|.:|
  Fly   161 QQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATNNVICVATPNKVSTCNGDSG 225

  Fly   206 S--ALIQNSRYMNKYRHIQFGIAT-VNDMDCEES--QGYTDVLKFYWWIQDVVSLFNHYSTNESY 265
            .  .|:.:|:.:        |:.: |:...||..  .|:|.|..:..||:.        :|..||
  Fly   226 GPLVLVSDSKLI--------GVTSFVSSAGCESGAPAGFTRVTSYLDWIKT--------NTGVSY 274

  Fly   266  265
              Fly   275  274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 50/222 (23%)
Tryp_SPc 44..249 CDD:214473 48/219 (22%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 55/242 (23%)
Tryp_SPc 40..269 CDD:238113 57/253 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436235
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.