DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG13527

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:248 Identity:45/248 - (18%)
Similarity:76/248 - (30%) Gaps:97/248 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FCAGTLITDVFILTAASCI------------------RPNAVKVRLGEFGRYPNE---LPEDHLV 99
            :|.|.|:::.:::|||.|:                  .|:.::...|:....|..   :|::   
  Fly    61 YCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKN--- 122

  Fly   100 HYFLMYRLFN------NESLANN---IGLLKLTKRV-------------------QITDYIMPVC 136
              |.|:..||      .|.:.:|   ||.|.|.|..                   .:..:|..|.
  Fly   123 --FTMHNTFNMALMKLQEKMPSNDPRIGFLHLPKEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVD 185

  Fly   137 IVLNPQNQQLSTMRFIGNAWMEDSNVSLTKELRPIVIQSKPKMCTNLDLYTQFCAGHQG---NLR 198
            :||.......:..|..|:..|                                |||:..   :..
  Fly   186 VVLMDNAVCKTYFRHYGDGMM--------------------------------CAGNNNWTIDAE 218

  Fly   199 SCDGLTGSALIQNSRYMNKYRH-IQFGIATVNDMDCEESQGYTDVLKFYWWIQ 250
            .|.|..||.|:.....:....: |..|...:..:       ||||.....||:
  Fly   219 PCSGDIGSPLLSGKVVVGIVAYPIGCGCTNIPSV-------YTDVFSGLRWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 45/248 (18%)
Tryp_SPc 44..249 CDD:214473 43/245 (18%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 45/248 (18%)
Tryp_SPc 43..263 CDD:214473 43/245 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.