DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and Jon44E

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:232 Identity:52/232 - (22%)
Similarity:89/232 - (38%) Gaps:52/232 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LLHTDGSIFCAGTLITDVFILTAASCIR-PNAVKVRLGEFGRYPNELPEDHLVHYFLMYRLFN-- 109
            |...||..:|.|::|...::||||.|.. .|.|.:..|...|:     |....|:.....:..  
  Fly    58 LSFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVLIYFGASFRH-----EAQYTHWVSRSDMIQHP 117

  Fly   110 --NESLANNIGLLK--------LTKRVQITDYIMPVCIVLNPQNQQLSTMRFIGNAW-MEDSNVS 163
              |:.|.|:|.|::        |..:|::..|        |.:....|....:.:.| :.|:|..
  Fly   118 DWNDFLNNDIALIRIPHVDFWSLVNKVELPSY--------NDRYNSYSGWWAVASGWGLTDNNSG 174

  Fly   164 LTKELRPIVIQSKPKMCTNLDLYTQF----------CAGHQGNLRSCDGLTGSALI--QNSRYMN 216
            ::..|..:.:|    :..|.|....:          |....|...||.|.:|..|:  .|:|.:.
  Fly   175 MSNYLNCVDVQ----IIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNNRIVG 235

  Fly   217 KYRHIQFGIATVNDMDCEESQ--GYTDVLKFYWWIQD 251
               .:.||    :...|...:  |:|.|..:..||:|
  Fly   236 ---IVSFG----SGEGCTAGRPAGFTRVTGYLDWIRD 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 52/232 (22%)
Tryp_SPc 44..249 CDD:214473 49/228 (21%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 49/228 (21%)
Tryp_SPc 41..266 CDD:238113 52/232 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.