DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG17572

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:276 Identity:64/276 - (23%)
Similarity:100/276 - (36%) Gaps:74/276 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CG--LMREEFSTSLG--PWTALL---HTDGSIF---CAGTLITDVFILTAASCIRPNA-----VK 80
            ||  |::..|...||  |:.|.:   |.:...|   |||.:|....|||||.|....|     ..
  Fly   124 CGKSLVQGHFYKGLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSS 188

  Fly    81 VRLGEFGRYPNELPE------------DHLVHYFLMYRLFNNESLANNIGLLKLTKRVQITDYIM 133
            ||:||:....:  |:            :|.:.:.:::..:......::|.||.|...:..:....
  Fly   189 VRVGEYDTSSD--PDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQ 251

  Fly   134 PVCIVLNPQNQQLSTMRFIGNAWMEDSNVSLTKELRPIVIQSKPKM------CTNLDLYTQ---- 188
            |:|:.....|..:.....|. .|.:.|..|:          .:|:|      .|:.||..:    
  Fly   252 PICLQKTRANLVVGKRATIA-GWGKMSTSSV----------RQPEMSHLDVPLTSWDLCLRNYGS 305

  Fly   189 --------------FCAGHQGNLRSCDGLTGSAL-IQNSRYMNKYRHIQFGIATVNDMDC---EE 235
                          .|||.:|. ..|.|..|:.| ||.:...:     |.||.:....:|   ..
  Fly   306 TGALESPNSIEGQWMCAGGEGK-DVCQGFGGAPLFIQENGIFS-----QIGIMSFGSDNCGGLRI 364

  Fly   236 SQGYTDVLKFYWWIQD 251
            ...||.|..|..||.|
  Fly   365 PSVYTSVAHFSEWIHD 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 58/259 (22%)
Tryp_SPc 44..249 CDD:214473 55/255 (22%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 59/262 (23%)
Tryp_SPc 138..378 CDD:214473 56/258 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.