DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG4650

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:267 Identity:76/267 - (28%)
Similarity:131/267 - (49%) Gaps:19/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SANYLYEQCGLMRE-EFSTSL-GPWTALLHTDGSIF-CAGTLITDVFILTAASCIRPNAVKV-RL 83
            |:.||..:|||:.. :.:.:: .||.|.|||...:: |.||:||:..:||||.|.|.:...| |:
  Fly    20 SSQYLDGRCGLLTNGKIANNISSPWMAYLHTSELLYVCGGTVITEKLVLTAAHCTRASEQLVARI 84

  Fly    84 GEF---GRYPNELPEDHLVHYFLMYRLFNNESLANNIGLLKLTKRVQITDYIMPVCIV-LNPQNQ 144
            |||   ....:.:..::.|....::.|:|..:.||:|.:|.|...:..:..|.|:||| .....:
  Fly    85 GEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICIVWWTIWRK 149

  Fly   145 QLSTMRFIGNA-WMEDSNVSLTKELRPIVIQSKP-KMCTNLD----LYTQFCAGHQGNLRSCDGL 203
            .:..::.:..| |...::.:.:...|...|:.:| .||:.|:    |.:||||| ..:.:.|:..
  Fly   150 YIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTLNGTAILSSQFCAG-DSDSKLCNVD 213

  Fly   204 TGSALIQNSRYMNKYRHIQFGIATVNDMDCEESQGYTDVLKFYWWIQDVVSLFNHYSTNESYIVN 268
            ..|.|.....:.|..|::..||||.| ..|:.:..|||||..   ...::|::..|...|.....
  Fly   214 FSSPLGAIITFKNIQRYVLIGIATTN-QKCKRASVYTDVLSH---TDFILSVWRQYRNGEKSPKT 274

  Fly   269 DYIKKNF 275
            ..::.||
  Fly   275 WDLQNNF 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 65/219 (30%)
Tryp_SPc 44..249 CDD:214473 65/216 (30%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 65/229 (28%)
Tryp_SPc 33..258 CDD:304450 65/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463266
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.