DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG9377

DIOPT Version :10

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:120 Identity:32/120 - (26%)
Similarity:57/120 - (47%) Gaps:8/120 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YLYEQCGLMREEFSTSLGPWTALLHTDGSIFCAGTLITDVFILTAASCIRPNAV-KVRL--GEFG 87
            |.....|..::|......||...::...:..|:|.|||.:.::|.|.|::.:.: ||||  ||:.
  Fly    95 YYLRPLGYKQQEAKFGEFPWLVAVYGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWD 159

  Fly    88 RYPNELPEDH---LVHYFLMYRLFNNESLANNIGLLKLTKR--VQITDYIMPVCI 137
            ......|:.|   .|...|::..:....||:||.:|.:.|.  .|:...:.|:|:
  Fly   160 AAVELEPQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..249 CDD:473915 29/102 (28%)
CG9377NP_609640.1 PRK06406 <19..>80 CDD:235796
Tryp_SPc 105..339 CDD:214473 30/110 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.