DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG9377

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:120 Identity:32/120 - (26%)
Similarity:57/120 - (47%) Gaps:8/120 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YLYEQCGLMREEFSTSLGPWTALLHTDGSIFCAGTLITDVFILTAASCIRPNAV-KVRL--GEFG 87
            |.....|..::|......||...::...:..|:|.|||.:.::|.|.|::.:.: ||||  ||:.
  Fly    95 YYLRPLGYKQQEAKFGEFPWLVAVYGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWD 159

  Fly    88 RYPNELPEDH---LVHYFLMYRLFNNESLANNIGLLKLTKR--VQITDYIMPVCI 137
            ......|:.|   .|...|::..:....||:||.:|.:.|.  .|:...:.|:|:
  Fly   160 AAVELEPQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 29/102 (28%)
Tryp_SPc 44..249 CDD:214473 29/102 (28%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 30/110 (27%)
Tryp_SPc 105..339 CDD:214473 30/110 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.