DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and Hayan

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:232 Identity:54/232 - (23%)
Similarity:93/232 - (40%) Gaps:37/232 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CAGTLITDVFILTAASCIRPNAVK---VRLGEFG-RYPNELPEDHLVHYFLMYRLFNNESLANNI 117
            |.|:||...|:||||.|:..:...   ||||... ..|....:|..|....::..::..|...:|
  Fly   414 CGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIENPEPGYQDINVIDVQIHPDYSGSSKYYDI 478

  Fly   118 GLLKLTKRVQITDYIMPVCIVLNPQNQQLSTMRFIGNAW--MEDSNVSLTKELRPIVIQSKPKMC 180
            .:|:|.:..:.:|.|.|.|:..:..:...:...|:. .|  |..:|.:::|.|....:...|...
  Fly   479 AILQLAEDAKESDVIRPACLYTDRSDPPANYKYFVA-GWGVMNVTNRAVSKILLRAALDLVPADE 542

  Fly   181 TNLD---------------LYTQFCAGHQGNLR-SCDGLTGSALIQNSRYMNKYRHI------QF 223
            .|..               :.:|.||..:...: :|.|.:|..||.....::....|      .|
  Fly   543 CNASFAEQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGF 607

  Fly   224 GIATVNDMDCEESQG-YTDVLKFYWWIQDVVSLFNHY 259
            |.||       ::.| ||.|..|..:|:.:|...|.:
  Fly   608 GCAT-------KTPGLYTRVSSFLDYIEGIVWPSNRF 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 52/223 (23%)
Tryp_SPc 44..249 CDD:214473 51/220 (23%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 51/220 (23%)
Tryp_SPc 385..630 CDD:238113 52/223 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.