DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG31220

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:293 Identity:79/293 - (26%)
Similarity:118/293 - (40%) Gaps:86/293 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ANYL--YEQCG--------LMREEFSTSLGPWTA-LLHTDGSIF---------CAGTLITDVFIL 68
            ||.|  |..||        :...|.:.:..||.| ||:.:.|.|         |.|:||...::|
  Fly    86 ANTLPSYPDCGKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVL 150

  Fly    69 TAASCIRPNAV---KVRLGEFGRYPNELPE------------DHL---VHYFLMYRLFN--NESL 113
            |||.|:....:   :|||||.....|  |:            .||   |.....:..::  |.:.
  Fly   151 TAAHCVTDTVLQIQRVRLGEHTTSHN--PDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTF 213

  Fly   114 ANNIGLLKLTKRVQITDYIMPVCIVLNPQNQQLSTMRF------IGNAWMEDSNVSLTKELRPIV 172
            .|:|.|::|.:.|:.|....|:|::..|:    |.|:|      .|...|.|:.   :|.|:...
  Fly   214 RNDIALVRLKEPVRYTMAYYPICVLDYPR----SLMKFKMYVAGWGKTGMFDTG---SKVLKHAA 271

  Fly   173 IQ-SKPKMCTNLDLYTQF------CAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQF--GIATV 228
            :: .||:.|:....:..|      |||...|..:|||.:||.|:..|.  ..|..|.|  ||.  
  Fly   272 VKVRKPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSG--RSYETITFLAGIT-- 332

  Fly   229 NDMDCEESQG-----------YTDVLKFYWWIQ 250
                   |.|           :|...|||.||:
  Fly   333 -------SYGGPCGTIGWPSVFTRTAKFYKWIR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 72/263 (27%)
Tryp_SPc 44..249 CDD:214473 70/260 (27%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 71/273 (26%)
Tryp_SPc 104..360 CDD:238113 73/275 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463514
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.