DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG8952

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:255 Identity:55/255 - (21%)
Similarity:103/255 - (40%) Gaps:81/255 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PWTALLHTDG--SIFCAGTLITDVFILTAASCIRPNAVKVRLGEFGRYPNELPEDHLVHYFLMY- 105
            ||..:|..|.  .:.|.|::|:|.::||||.|                     .:.|...|||: 
  Fly    50 PWQVILKRDAWDDLLCGGSIISDTWVLTAAHC---------------------TNGLSSIFLMFG 93

  Fly   106 --RLFN-----------------NESLANNIGLLKLTKRVQITDYIMPVCIVLNPQNQQLSTMRF 151
              .|||                 |:.|.|::.|::|.:.:..:..|..:.:|    .|...::.:
  Fly    94 TVDLFNANALNMTSNNIIIHPDYNDKLNNDVSLIQLPEPLTFSANIQAIQLV----GQYGDSIDY 154

  Fly   152 IGN-------AWMEDSNVSLTKELRPIVIQSKPKMCTNLD---LYTQF-------CA-GHQG-NL 197
            :|:       .:.||..:..::.|    :.::.::..|.|   :|.::       || |..| ::
  Fly   155 VGSVATIAGFGYTEDEYLDYSETL----LYAQVEIIDNADCVAIYGKYVVVDSTMCAKGFDGSDM 215

  Fly   198 RSCDGLTGSALIQNSRYMNKYRHIQFGIATVNDMDCEES------QGYTDVLKFYWWIQD 251
            .:|.|.:|..||..::.:.:::  |.||   |....|:.      .||..|..|..:|.|
  Fly   216 STCTGDSGGPLILYNKTIQQWQ--QIGI---NSFVAEDQCTYRLPSGYARVSSFLGFIAD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 55/255 (22%)
Tryp_SPc 44..249 CDD:214473 53/251 (21%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 53/251 (21%)
Tryp_SPc 38..271 CDD:238113 55/255 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436499
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.