DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG18420

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:270 Identity:84/270 - (31%)
Similarity:126/270 - (46%) Gaps:25/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MLVIYSDSVSANYLYEQCGLMREEFSTSLG--------------PWTALLHTDGSIF-CAGTLIT 63
            :|.::....|..:|..:||   ......||              ||.|.|||..:.| |.||||:
  Fly    14 LLTVFPLLGSTQFLDSECG---TRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLIS 75

  Fly    64 DVFILTAASCIRPN-AVKVRLGEFGRYPNELPEDHLVHYFLMYRLFNNESLANNIGLLKLTKRVQ 127
            ...:||||.|..|| .:.|||||:.|......|:|.|:....:|.::..:.||:|.||:|...|.
  Fly    76 RRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEHQVNRTFQHRFYDPNTHANDIALLRLVSNVV 140

  Fly   128 ITDYIMPVCIVLNPQ-NQQLSTMRFI-GNAWMEDSNVSLTKELRPIVIQSKP-KMCT-NLDLYTQ 188
            ....|.|:||:.:.. ...:.:::.: |..|....::..:.|||.:.|..:| |||. ...|..|
  Fly   141 YKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMCAFGSVLSNQ 205

  Fly   189 FCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVNDMDCEESQGYTDVLKFYWWIQDVV 253
            ||||: .|...|.|.||..:....||.|.:|.:|.|||..|.. |:....:|||:....:|:.:.
  Fly   206 FCAGN-WNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKR-CQRPSVFTDVMSHIEFIRRIF 268

  Fly   254 SLFNHYSTNE 263
            ...|....|:
  Fly   269 LTQNGNDRNQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 75/213 (35%)
Tryp_SPc 44..249 CDD:214473 74/210 (35%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 74/223 (33%)
Tryp_SPc 43..267 CDD:238113 75/225 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463265
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.