DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG33462

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:273 Identity:80/273 - (29%)
Similarity:130/273 - (47%) Gaps:31/273 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LYEQCGLMREEFSTSL------GPWTALLHTDGSIFCAGTLITDVFILTAASCIRPN-AVKVRLG 84
            |.|.||:.......|:      .||.|.|.|.....|:||||..:|:||||.|:..: .:.||||
  Fly    25 LEEDCGIPHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLG 89

  Fly    85 EFGRYPNELPEDHL---------VHYFLMYRLFNNESLANNIGLLKLTKRVQITDYIMPVCIVLN 140
            |:........::||         |.....:|.:|.....|:||:|:|.:||:..::|.|:||..:
  Fly    90 EYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFAS 154

  Fly   141 PQNQ----QLSTMRFIGNAWMEDSNVSLTKELRPIVIQSKPK-MCTNL----DLYTQFCAGHQ-G 195
            .:.|    ||:.  |....|.|.:..:.:|.||.:.|..:|| .|:.:    ..:.|.|||:. .
  Fly   155 NRFQEPIDQLTW--FTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLS 217

  Fly   196 NLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVNDMDCEESQGYTDVLKFYWWIQDVVSLFNHYS 260
            .|.|.|  :|:..|:...:....|::|.|||:.....|:.|....|:|.:..||:.||..:.. |
  Fly   218 QLCSTD--SGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGILMDLLSYADWIKRVVRQYGP-S 279

  Fly   261 TNESYIVNDYIKK 273
            |:.:..:..::.|
  Fly   280 TDMNRSLKKWVDK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 70/227 (31%)
Tryp_SPc 44..249 CDD:214473 68/224 (30%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 70/227 (31%)
Tryp_SPc 48..269 CDD:214473 68/224 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463322
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.