DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and Sp212

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:241 Identity:61/241 - (25%)
Similarity:110/241 - (45%) Gaps:35/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EFSTSLGPW-TALLHTDG---SIFCAGTLITDVFILTAASCIR---PNAVKVRLGEF--GRYPNE 92
            ||.....|| :|:.|.:.   :..|.|:||:...:::||.|:.   .:.|.|.||.:  ..|..:
  Fly   282 EFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGED 346

  Fly    93 LPEDHLVHYFLMYRLFNNESLAN-NIGLLKLTKRVQITDYIMPVCIVLNPQNQQLSTMRFIGNAW 156
            ..|...|...|.:..:|..|.:: :|.|:.:.:.|...|.|.|:|:.....::.:||..||. .|
  Fly   347 GAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMWTVEASRTVSTTGFIA-GW 410

  Fly   157 MEDSNVSLTKELRPIVIQSK---PKMCTNL---DLYTQ--FCAGHQGNLRSCDGLTGSALI--QN 211
            ..|.:.|.|:  .|.|::::   |.:|.:.   .:.|:  .|||::.....|.|.:|..|:  |.
  Fly   411 GRDEDSSRTQ--YPRVVEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQG 473

  Fly   212 SRYMNKYRHIQFGIATVNDM----DCEESQG--YTDVLKFYWWIQD 251
            .|::.:      ||.:..:.    .|:.:|.  |.|:.|...||.:
  Fly   474 DRWLLR------GIVSAGERGPAGTCQLNQYVLYCDLSKHINWISE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 59/234 (25%)
Tryp_SPc 44..249 CDD:214473 57/230 (25%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 61/241 (25%)
Tryp_SPc 277..511 CDD:214473 59/237 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437308
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.