DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG30286

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:277 Identity:80/277 - (28%)
Similarity:126/277 - (45%) Gaps:36/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ISLLASYMLVIYSDSVSANYLYEQCG------LMREEFST--SLGPWTALLHTDGSIFCAGTLIT 63
            |.||.|  |:.:....:|.:|...||      |..||...  |..||.|.||..|.:.|.|||:.
  Fly     4 ILLLTS--LLPWHPHATAQFLEPDCGYMSPEALQNEEHQAHISESPWMAYLHKSGELVCGGTLVN 66

  Fly    64 DVFILTAASCIRPNA-VKVRLGEFGRYPNE-------LP--EDHLVHYFLMYRLFNNESLANNIG 118
            ..||||||.|||.:. :.||||||....:.       ||  ||..:.....:..::..:..::||
  Fly    67 HRFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIG 131

  Fly   119 LLKLTKRVQITDYIMPVCIVLN----PQNQQLSTMRFIGNAWMEDSNVSLTKELRPI-VIQSKPK 178
            ||:|.|.|:...:|.|:|::.|    |:.::|.  |.:...|....:.:....|:.| |.:....
  Fly   132 LLRLAKSVEYKVHIKPICLITNTTLQPKIERLH--RLVATGWGRSPSEAANHILKSIRVTRVNWG 194

  Fly   179 MCTNLDLY------TQFCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVNDMDCEESQ 237
            :|:.  .|      .|.|..|:..: ||.|.:|..:.|..|...:...:|.||.:..:.:|....
  Fly   195 VCSK--TYWVDRRRDQICVSHESGV-SCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLSPS 256

  Fly   238 GYTDVLKFYWWIQDVVS 254
            .:|:|::...||...:|
  Fly   257 VFTNVMEHIDWIMAALS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 66/228 (29%)
Tryp_SPc 44..249 CDD:214473 64/225 (28%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 66/234 (28%)
Tryp_SPc 39..268 CDD:214473 65/233 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463268
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.