DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG30098

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:226 Identity:58/226 - (25%)
Similarity:98/226 - (43%) Gaps:37/226 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PWTALLHTDGSIFCAGTLITDVFILTAASCIRPN-AVKVRLGEFGRYPNELPEDHLVHYFLMYRL 107
            ||.|.|..|....|.|:||...|:||||.|.:.| .:.|||||   |.:....|.....:.:..:
  Fly    47 PWMAYLIRDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGE---YDSSRTTDGQTRSYRVVSI 108

  Fly   108 FNNESLA----NNIGLLKLTKRVQITDYIMPVCIVLNPQNQQL--STMRFIGNAWMEDSNVSLTK 166
            :.:::..    ::|.:|||.::|....||.|:||:||...|.|  |...|....|.:.::..   
  Fly   109 YRHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYY--- 170

  Fly   167 ELRPIVIQSKPKMCTNLD------LYTQFCAGHQGNL-------RSCDGLTGSALIQNSRYMNKY 218
                       ||.|.|.      :..::|.....::       .:|.|.:|..|....:|.:|.
  Fly   171 -----------KMPTTLQEMSLRRVRNEYCGVPSLSICCWNPVQYACFGDSGGPLGSLVKYGHKT 224

  Fly   219 RHIQFGIATVNDMDCEESQGYTDVLKFYWWI 249
            .::|||:......:|:....|.|::.:..|:
  Fly   225 IYVQFGVTNSVTGNCDGYSSYLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 58/226 (26%)
Tryp_SPc 44..249 CDD:214473 57/224 (25%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 57/223 (26%)
Tryp_SPc 37..258 CDD:238113 58/226 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463382
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.