DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG30090

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:273 Identity:84/273 - (30%)
Similarity:121/273 - (44%) Gaps:48/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SANYLYEQCGLMREEFSTSL----------GPWTALLHTDGSIFCAGTLITDVFILTAASCIRP- 76
            :..||..:|||.....:..:          .||.|.:|:...:.|.|||||..|:||||.|:.. 
  Fly    21 NGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICGGTLITQRFVLTAAHCVNEG 85

  Fly    77 NAVKVRLGEFGRYPNE-------LP--EDHLVHYFLMYRLFNNESLANNIGLLKLTKRVQITDYI 132
            :||||||||:.....|       :|  |:|.|.....:..|:.....|:|.||:|.|.|....:|
  Fly    86 SAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHI 150

  Fly   133 MPVCIVLNPQNQQL--STMRFIGNAWMEDSNVSLTKELRPIVIQSKPKMCTNLDLY--------- 186
            .|:||:|....::|  |...|:...|.|    :.|...|.::      ..|.|..|         
  Fly   151 SPICIILGTSKRELVDSIEWFVATGWGE----TRTHRTRGVL------QITQLQRYNSSQCMQAL 205

  Fly   187 ------TQFCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVNDMDCEESQGYTDVLKF 245
                  .|.|||..|: .:|:|.:|..|.|..|:|:|.|.:|||:.:....:|.....||||..:
  Fly   206 GRLVQQNQICAGRLGS-DTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIGVYTDVYSY 269

  Fly   246 YWWIQDVVSLFNH 258
            ..||..||....|
  Fly   270 ADWIATVVQQNTH 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 76/234 (32%)
Tryp_SPc 44..249 CDD:214473 74/231 (32%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 74/244 (30%)
Tryp_SPc 40..276 CDD:238113 76/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463274
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.