DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG30087

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:260 Identity:69/260 - (26%)
Similarity:117/260 - (45%) Gaps:40/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VSANYLYEQCGLMREEFSTSL------------GPWTALLHTDGSIFCAGTLITDVFILTAASCI 74
            |.|.:|...||:..|. .|::            .|:...:..:....|.|:::...:|||||.|:
  Fly    21 VDAQFLNPLCGVTYES-QTAMRVVNGKEAVIRSAPFMVYVTNNSLTHCGGSILNSRYILTAAHCV 84

  Fly    75 RPNAVKVRLGEF---------GRYPNELPEDHLVHYFLMYRLFNNESLANNIGLLKLTKRVQITD 130
            .|| :::||||.         |...:...|::.:...:.:|.:|..:..|:|.||||.:.:....
  Fly    85 FPN-LRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNV 148

  Fly   131 YIMPVCIVLNPQN-QQLSTMRFIGNAWMEDS-----NVSLTKELRPIVIQSKPKMCT-NLDLY-- 186
            :|.|:||:|||.: ..::|.:..|  |.|..     ::..|.|||..    ....|: :...|  
  Fly   149 HIQPICILLNPASAPSVATYQTFG--WGETKKNGFPHLLQTAELRAY----DAAYCSRSFHAYMN 207

  Fly   187 -TQFCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVNDMDCEESQGYTDVLKFYWWIQ 250
             .|.||||: ...:|.|.:|..|:....:....|::|.||.:....||:....||.|..:..||:
  Fly   208 GNQICAGHE-ERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGVYTYVPNYINWIR 271

  Fly   251  250
              Fly   272  271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 62/226 (27%)
Tryp_SPc 44..249 CDD:214473 60/223 (27%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 60/236 (25%)
Tryp_SPc 42..272 CDD:238113 62/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463293
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.