DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG30083

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:268 Identity:71/268 - (26%)
Similarity:116/268 - (43%) Gaps:42/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YMLVIYSDSVSANYLYEQCG--------LMREEFSTSLGPWTALL--HTD---GSIFCAGTLITD 64
            :.:::......:.:|...||        :..:.......||.|.:  :.|   ..:.|.||||..
  Fly     7 FKIILLWPGAMSQFLEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHK 71

  Fly    65 VFILTAASCI-RPNAVKVRLGEFGRYPNELPEDHLVHYFLMYRLFNNE-----SLANNIGLLKLT 123
            .|:|:||.|| |...:.|||||...          ..||.:.:.|.|:     |.:|:||:|::.
  Fly    72 QFVLSAAHCIKRDQILAVRLGEHSS----------SRYFAVTKAFRNKYFTTGSYSNDIGILRIQ 126

  Fly   124 KRVQITDYIMPVCIVLNPQN-QQLSTMRFIGNAWMEDSNVSLTKELRPIVI-QSKPKMCTNLDLY 186
            ..|:....|.|:||:.:|.. ..:.|.:..|  |.:..|.:.:|.|:.:.: :.....|.|: |:
  Fly   127 PIVKFNAVIRPICIITDPTKVPNVKTFKAAG--WGKTENETFSKVLKTVELNELNASECYNM-LW 188

  Fly   187 -----TQFCAGH-QGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVNDMDCEESQGYTDVLKF 245
                 :|.|||| .|:  :|.|.:|..||.........|::|.||.:.....|.....||.:..|
  Fly   189 VNVTESQICAGHPDGD--TCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSPGVYTRLSSF 251

  Fly   246 YWWIQDVV 253
            ..||..||
  Fly   252 IDWILMVV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 66/226 (29%)
Tryp_SPc 44..249 CDD:214473 64/223 (29%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 64/236 (27%)
Tryp_SPc 34..255 CDD:238113 64/235 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.