DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and try-3

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:254 Identity:63/254 - (24%)
Similarity:102/254 - (40%) Gaps:66/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 WTALLHTDG----SIFCAGTLITDVFILTAASCIRPNAVKVRLGEF--GRYP-NELPEDHLVHYF 102
            |.|.|.:.|    .|.|..|:|.|.:::|||.|    |::::...|  .|.| |.......|...
 Worm    50 WMAKLVSYGDNGQGILCGATVIDDFWLVTAAHC----ALQLQTRSFVYVREPKNNRERSFSVKEA 110

  Fly   103 LMYRLFNNESLANNIGLLKLTKRVQITDYIMPVCIVLNPQN--QQLSTMRFIGNAWM--EDSNVS 163
            .::..:||::..|:|.||:::..:.... |.|||:|.:...  :|......||....  |||:. 
 Worm   111 YIHSGYNNQTADNDIALLRISSDLSKLG-IKPVCLVHDDSKLLKQYKNGVVIGYGLTLGEDSSG- 173

  Fly   164 LTKELRPIVIQSKPKMCTNLDLYT---------------------QFCAG---HQGNLRSCDGLT 204
                 .|.:|.|:....|::.:.:                     |.|||   |    .:..|.:
 Worm   174 -----EPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQICAGAYLH----GTAPGDS 229

  Fly   205 GSALI---QNSRYMNKYRHIQFGIAT--VNDMDCEESQG-----YTDVLKFYWWIQDVV 253
            |..|:   .|..|      :|.||.:  .:.:|....||     ||.:.|:..|||.|:
 Worm   230 GGPLLIHKSNGEY------VQIGITSYGADGLDGVIDQGKFPGVYTRISKYVPWIQGVI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 62/251 (25%)
Tryp_SPc 44..249 CDD:214473 59/248 (24%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 60/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.