DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG43742

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:276 Identity:78/276 - (28%)
Similarity:125/276 - (45%) Gaps:29/276 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVIYSDSVSANYLYEQCGL-----MREEFSTSLGPWTALLHTDGSIFCAGTLITDVFILTAASCI 74
            :|||.::. |..|.|.|.:     :....:.....:.|.|:.:...||.|:||...::||||.|:
  Fly    12 VVIYQNAF-AQLLDENCKVKITYRVANGHTAITSQFMAALYNNSEFFCGGSLIHKQYVLTAAHCV 75

  Fly    75 RP-NAVKVRLGEFGRYPNELPEDHLVHYF------LMYRLFNNESLANNIGLLKLTKRVQITDYI 132
            |. :.|.|.|||..|   ..|.....|..      :::..|:.....|:|.||:|.:.|....:|
  Fly    76 RDLDEVTVHLGENNR---SCPIPVCKHVLRLNAKVILHPNFHGNIFLNDIALLRLEREVIFEAHI 137

  Fly   133 MPVCIVLNPQNQQLSTMRFIGNAWMEDSNVSLTKELRPIVIQSKPK-MC-TNLDLYTQFCAGHQG 195
            .|:||:|:......:...|....|.:..:.:::..|..|.:...|| || .|::   ..|||...
  Fly   138 RPICIILDEDVTSNNQNNFTAYGWGKTEHGNISDVLSFIDLVRLPKSMCYQNIN---TICAGSTS 199

  Fly   196 NLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVNDMDCEESQG-YTDVLKFYWWIQDVVSLFNHY 259
            . .:|:..:|..||.|..:..|.|.|.|||.:..|.:|....| ||||..:..||..||      
  Fly   200 G-DTCESDSGGPLIGNFVHRGKSRDILFGITSYGDAECSGLFGVYTDVNAYKSWIASVV------ 257

  Fly   260 STNESYIVNDYIKKNF 275
            ..:|..::|:|.|.::
  Fly   258 LESEPRLLNEYCKSDW 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 65/217 (30%)
Tryp_SPc 44..249 CDD:214473 63/214 (29%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 63/225 (28%)
Tryp_SPc 35..256 CDD:238113 65/227 (29%)
Tryp_SPc 273..467 CDD:214473 0/1 (0%)
Tryp_SPc 273..>368 CDD:304450 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463380
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.