DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG43335

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:233 Identity:73/233 - (31%)
Similarity:116/233 - (49%) Gaps:27/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PWTALLHTDGSIFCAGTLITDVFILTAASCIRPNA-VKVRLGEFGRYPNE------LPEDHLVHY 101
            ||.|.|:.:...||||||||:.|:||||.||..:. :.||||..|...::      ..||:.|..
  Fly    54 PWMAYLYNEFHYFCAGTLITNQFVLTAAHCIEASKNLTVRLGGSGLTRSDGSMCQITAEDYSVSM 118

  Fly   102 FLMYRLFNNESLANNIGLLKLTKRVQITDYIMPVCIVLNPQNQQL--STMRFIGNAW-MEDSNVS 163
            .:.::.|....:.|:|.:::|.:.|:..|:|.|:||:|:|..:.|  ..|..:...| :.|    
  Fly   119 AIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLAD---- 179

  Fly   164 LTKELRPIVIQSKP------KMCTNL-DL---YTQFCAGHQGNLRSCDGLTGSALIQNSRYMNKY 218
              |.:.|.::|..|      .:|:.| |:   ..|.|||.: ...:|.|.:|..|.....|....
  Fly   180 --KRMHPHLLQEAPITVMNRNVCSKLYDVAITQGQICAGDK-ETNTCLGDSGGPLGGVVNYYGDL 241

  Fly   219 RHIQFGIATVNDMDCEESQGYTDVLKFYWWIQDVVSLF 256
            |.:|:||.:..|::|.....|||:..:..||..|||.:
  Fly   242 RFVQYGITSFGDIECRSPSIYTDLSTYSGWINMVVSQY 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 70/227 (31%)
Tryp_SPc 44..249 CDD:214473 68/224 (30%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 68/224 (30%)
Tryp_SPc 42..275 CDD:238113 70/227 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463275
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.