DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG43110

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:246 Identity:69/246 - (28%)
Similarity:107/246 - (43%) Gaps:28/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YLYEQCG-------LMREEFSTSLGPWTALLHTDGSIFCAGTLITDVFILTAASCIRPNAVKVRL 83
            :|.:.||       :.....|.....:.|.:.....:.|.||:|.:.|:||.|.|.....:.|||
  Fly    23 FLKQPCGKTPVPKIISGSNASQQSAQYMAGIFNTTHLLCGGTIIHEDFVLTVAHCKSTQTLFVRL 87

  Fly    84 GEFGRYPNELPEDHL-VHYFLMYRLFNNESLANNIGLLKLTKRVQITDYIMPVCIVLNPQ-NQQL 146
               |.|....|.|.: |...:.:..::|.:.||:|.|:||.:.|.....|.|:||.|:.. .:|:
  Fly    88 ---GAYNINHPTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHLDATLGKQI 149

  Fly   147 STMRFIGNAWMEDSNVSLTKELRPIVI-QSKPKMCTNLDLY-------TQFCA-GHQGNLRSCDG 202
            ......|  |....|...:..|:.|.: ::.|.:|   .||       .|.|| ..||:  :|.|
  Fly   150 RYYNAFG--WGRTRNAEQSDILQRIFVNRTNPMIC---HLYLGMSPDPKQICATTDQGD--TCAG 207

  Fly   203 LTGSALIQNSRYMNKYRHIQFGIATVNDMDCEESQGYTDVLKFYWWIQDVV 253
            .:|..||....|..|....||||.:....:|.....||||.::..||.::|
  Fly   208 DSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGLYTDVSQYSGWIANIV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 64/218 (29%)
Tryp_SPc 44..249 CDD:214473 62/215 (29%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 63/228 (28%)
Tryp_SPc 36..257 CDD:238113 65/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463378
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.