DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG43124

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:263 Identity:74/263 - (28%)
Similarity:118/263 - (44%) Gaps:44/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNATLTISLLASYMLVIYSDSVSANYLYEQCGLMREEFS-TSLGPWTALLHTDGSIFCAGTLITD 64
            ||....|.|  ..:|:.|..  ||..|.|.|....|..: :|..||.|.:.:|..:.|||.||.:
  Fly     1 MNTARWIVL--CIVLMFYQG--SAQTLEEDCVDHMERINGSSYAPWLAEILSDSKVICAGALINN 61

  Fly    65 VFILTAASCIRPN-AVKVRLGEFGRYPNELPEDHLV--HYFLMYRLFNNESLANNIGLLKLTKRV 126
            :::||||||.:.| .:.||||  ..|.::..|:..|  .||.|.....|.:  ||:.:.:|...|
  Fly    62 LYVLTAASCFKENEKLTVRLG--SGYFDKSYENFRVTKAYFWMTHFPANNT--NNLCIFRLQTEV 122

  Fly   127 QITDYIMPVCIVLNPQNQQLSTMRFIGNAWMEDSNVSLTKELRPIVIQSKPKM---CTNL-DLYT 187
            :...:|.|:||..:|::..|:|                |.|    :|..||||   |.|: .|:.
  Fly   123 EFKTHIRPMCITKSPKSLGLAT----------------TFE----IINEKPKMWYFCKNIKGLFC 167

  Fly   188 QFCAGHQGNLRSCDGLTGS---ALIQNSRYMNKYRHIQFGIATVNDMDCEESQGYTDVLKFYWWI 249
            ::..| :...:.....|||   ..|.|..:...   :::||.:..|....: :.|.:|:....||
  Fly   168 KYVFG-ENEEKWQSKPTGSPWTETISNGPFKGL---VRYGILSYRDNKTYD-EVYINVMSHINWI 227

  Fly   250 QDV 252
            ..:
  Fly   228 AQI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 61/217 (28%)
Tryp_SPc 44..249 CDD:214473 59/214 (28%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 33/95 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.