DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG43125

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:278 Identity:80/278 - (28%)
Similarity:119/278 - (42%) Gaps:68/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNATLTISLLASYMLVIYSDSVSANYLYEQCGLMREEFSTSLGPWTALLHTD--GSIFCAGTLIT 63
            |:|||.:::.|  :|:.|..  ||.:|.:.|| ....||.:  ||...:..:  .:|.|.||||.
  Fly     1 MSATLRLAVFA--LLLFYQG--SALFLEQNCG-KSSVFSPA--PWLVKIRPELSSNITCTGTLIN 58

  Fly    64 DVFILTAASCI-RPNAVKVRLGEF-GRYPNELP---EDHLVHYFLMYRLFNNESLANNIGLLKLT 123
            :.|:||||||| ....:.|||||. |...|...   |:..|...|::|.:::||...||.||:|.
  Fly    59 ERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYNIALLRLK 123

  Fly   124 KRVQITDYIMPVCIVLN-------------------PQNQQLSTM-RFIGNAWMEDSNVSL--TK 166
            ..|.....|.|:||.:|                   |:..:...| ||:.  |.    :||  .:
  Fly   124 TSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLN--WF----LSLFGVR 182

  Fly   167 ELRPIVIQSKPKMCTNLDLYTQFCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVNDM 231
            |.||.||.....:.....|..|              :..|||..           |:||.:..:.
  Fly   183 EPRPDVILPPQPIAVGWPLTKQ--------------INESALFH-----------QYGILSHRNS 222

  Fly   232 DCEESQGYTDVLKFYWWI 249
            :.::.. ||||:.:..||
  Fly   223 ESKKDV-YTDVMAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 66/235 (28%)
Tryp_SPc 44..249 CDD:214473 64/233 (27%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 37/99 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.