DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG42694

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:289 Identity:81/289 - (28%)
Similarity:125/289 - (43%) Gaps:50/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MLVIYSDSVSANYLYEQCGL-MREEFSTSL----GPWTALLHTDGSIFCAGTLITDVFILTAASC 73
            ||.:....|::.:|.:.||. :..:..|.|    ..|.|.:.....:.|:|:||:..|:|:||.|
  Fly    10 MLTVLQSHVNSKFLDDYCGAPISNQSITKLRQPQAGWLAHISNGTHVLCSGSLISKQFVLSAAQC 74

  Fly    74 IRPNA-VKVRLGEFGRYPNELPEDHLVHYFLMYRLFN-------NESLANNIGLLKLTKRVQITD 130
            |..:. :.|:||    ..|.....|      .|.:.|       .:.|..:||||||::.|...|
  Fly    75 IDVHGKLFVQLG----VSNATKSPH------WYTVSNVVIPSHSGKRLQRDIGLLKLSQSVDYND 129

  Fly   131 YIMPVCIVLNPQNQQLSTM--RFIGNAWMEDSNVSLTKELRPIVIQSKPKMCTNLDLY-----TQ 188
            ::.|:||.||.....:..:  .|..:||:     |..|..:.||:....:....|:|.     .:
  Fly   130 FVYPICIALNTNTLDMVKILQNFTTSAWL-----SKNKNPQTIVLSQLSRDRCKLNLSGNVTPKE 189

  Fly   189 FCAGHQGNLRSCDGLTGSAL----IQNSRYMNKYRHIQFGI-ATVNDMD-CEESQGYTDVLKFYW 247
            .||.......||...:||||    ||.|   |..|.:.||| ..||... |.|...|.||.:...
  Fly   190 ICAASLQRNNSCFIDSGSALTQPIIQGS---NIVREMLFGIRGYVNGRSWCSEPAIYIDVAECVG 251

  Fly   248 WIQDVVSLFNHYSTNESYI----VNDYIK 272
            ||:.||..::  .|:...:    ||.::|
  Fly   252 WIETVVQQYD--GTDSRAVATPEVNQHLK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 67/228 (29%)
Tryp_SPc 44..249 CDD:214473 65/225 (29%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 67/227 (30%)
Tryp_SPc 46..253 CDD:214473 65/224 (29%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463384
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.