DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and KLK4

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_004908.4 Gene:KLK4 / 9622 HGNCID:6365 Length:254 Species:Homo sapiens


Alignment Length:275 Identity:67/275 - (24%)
Similarity:110/275 - (40%) Gaps:52/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IGLVLCQGLAQLLDKKCHDPKTSENINFNHGATETAPWMASIYKNNQFICDGTLVHKLFVLTAAS 74
            :|.::......|:...|     |:.||....:..:.||.|::...|:..|.|.|||..:||:||.
Human    12 LGYLILGVAGSLVSGSC-----SQIINGEDCSPHSQPWQAALVMENELFCSGVLVHPQWVLSAAH 71

  Fly    75 CISKDSQLYVL-FGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAH 138
            |....   |.: .|:::  .:|.|...::....:::::|..:......||:.|::|...|:....
Human    72 CFQNS---YTIGLGLHS--LEADQEPGSQMVEASLSVRHPEYNRPLLANDLMLIKLDESVSESDT 131

  Fly   139 IRPI------------CIILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRN 191
            ||.|            |::               .||..........|.|.|.:|......|.:.
Human   132 IRSISIASQCPTAGNSCLV---------------SGWGLLANGRMPTVLQCVNVSVVSEEVCSKL 181

  Fly   192 GQLLPINEGQFCA--GNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPT---SVY 251
            ...| .:...|||  |...:..|..:||.||       :.|..:| ||||:|...|...   .||
Human   182 YDPL-YHPSMFCAGGGQDQKDSCNGDSGGPL-------ICNGYLQ-GLVSFGKAPCGQVGVPGVY 237

  Fly   252 TDVVAFKDWIYNTVR 266
            |::..|.:||..||:
Human   238 TNLCKFTEWIEKTVQ 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 59/235 (25%)
Tryp_SPc 46..261 CDD:214473 57/232 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
KLK4NP_004908.4 Tryp_SPc 31..250 CDD:238113 61/247 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.