DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and tmprss4a

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_005157547.1 Gene:tmprss4a / 777630 ZFINID:ZDB-GENE-061103-631 Length:458 Species:Danio rerio


Alignment Length:254 Identity:62/254 - (24%)
Similarity:104/254 - (40%) Gaps:61/254 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYKNNQFICDGTLVHKLFVLTAASCISKD-----SQLYVLFGMYNQYRDASQFFNNEQYG 105
            ||..|:..:.|..|.|:||...:|:|||.|.:.|     |:..|:.|:.......|.:       
Zfish   236 PWQVSLQYSGQHTCGGSLVTPNWVVTAAHCFNGDGRKALSRWTVVSGITYLSSTPSSY------- 293

  Fly   106 VAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHV-VKSAPFERFEGF---GW--- 163
            |...:.:||::|.....||.:::|...:|.....||:|:...:: :|..     :|.   ||   
Zfish   294 VKEIIVNSNYKPAESDFDITMIKLQSPITLSESRRPVCLPPQNLGLKGG-----DGLVVTGWGHM 353

  Fly   164 QQQGTEASSQVRQ--------------TVYLSQKKPFECHRNGQLLPINEGQFCAGNRDRSF--C 212
            .::|...||.:::              |||.|.              |.....|||......  |
Zfish   354 AEKGGSLSSMLQKAQIQVIDSAQCSSPTVYGSS--------------ITPRMICAGVMAGGVDAC 404

  Fly   213 RSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSP--TSVYTDVVAFKDWIYNTVRNFE 269
            :.:||.||.     .:.:..|.||:||:|.....|  ..|||:|....||.::.::.::
Zfish   405 QGDSGGPLV-----HLADRWVLVGVVSWGVGCARPGFPGVYTNVDQMLDWAHSVMQTYK 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 62/247 (25%)
Tryp_SPc 46..261 CDD:214473 61/244 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
tmprss4aXP_005157547.1 LDLa 74..105 CDD:238060
SRCR_2 121..218 CDD:295335
Tryp_SPc 223..449 CDD:214473 60/243 (25%)
Tryp_SPc 224..449 CDD:238113 60/243 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.