DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and XB5723326

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001037931.1 Gene:XB5723326 / 733551 XenbaseID:XB-GENE-5723327 Length:349 Species:Xenopus tropicalis


Alignment Length:254 Identity:66/254 - (25%)
Similarity:107/254 - (42%) Gaps:47/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYKNNQF----ICDGTLVHKLFVLTAASCISKD-------SQLYVLFGMYNQYRDASQF- 98
            ||:.||.|..:.    ||.||:::..:::|||.|. ||       :.|.||.|.:.    .|:. 
 Frog    28 PWIVSIQKKVELGYKHICAGTILNNEWIITAAHCF-KDWKEGDPTTPLRVLLGTFY----LSEIG 87

  Fly    99 FNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICI---------ILDHVVKSAP 154
            ...:..||...::|..:.|....|||.|::|..:|....||:..|.         ::|..:.   
 Frog    88 LRTQSRGVKQLIKHDQYDPITESNDIALIQLDKQVEFSDHIQQACFPKESADLKDLIDCSIA--- 149

  Fly   155 FERFEGFGWQQQG--TEASSQVRQTVYLSQKKPFECHRNGQLLPINEGQFCAGNR--DRSFCRSN 215
                   ||..||  .:..||..|...:.:.....|::..|.: :.|...|||:|  ....|..:
 Frog   150 -------GWGAQGKHLDEPSQFLQEAQVERIDTKHCNKWYQGI-LGENHLCAGHRKGPEKTCNGD 206

  Fly   216 SGSPLTADFTYGVKNITVQVGLVSYGSELCSPT---SVYTDVVAFKDWIYNTVRNFETK 271
            .||||..  .....|:...:|::::||. |..|   .||:.:.:...||...|:|...|
 Frog   207 RGSPLMC--RTKKNNVYSVIGILNWGSG-CGQTRSPGVYSPIQSHIKWIVEKVKNEAVK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 63/245 (26%)
Tryp_SPc 46..261 CDD:214473 61/242 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
XB5723326NP_001037931.1 Tryp_SPc 25..252 CDD:214473 61/242 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.