DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and Tmprss11a

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_038948511.1 Gene:Tmprss11a / 686581 RGDID:1596322 Length:387 Species:Rattus norvegicus


Alignment Length:251 Identity:69/251 - (27%)
Similarity:105/251 - (41%) Gaps:50/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 INFNHGATETAPWMASIYKNNQFICDGTLVHKLFVLTAASCISKDS---QLYVLFG-------MY 89
            ::.|..|....||..|:.:||...|.|||:..::|:|||.|...::   |..:.||       |.
  Rat   157 VSGNPAAKGAWPWQVSLQRNNIHQCGGTLIGNMWVVTAAHCFRTNANPRQWTLSFGTTINPPLMK 221

  Fly    90 NQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAP 154
            .:.|.              .:.|..:||....:||.|::....||....:|.||:    ...||.
  Rat   222 REVRR--------------IIMHEKYRPPARDHDIALVQFSPRVTFSDEVRRICL----PEPSAS 268

  Fly   155 FE-----RFEGFGWQQQGTEASSQVRQ--TVYLSQKKPFECHRNGQLLPINEGQFCAGNRDRSF- 211
            |.     ...|||....|.|:.:::|:  ...:|.....:.|..|.  .|..|.||||..:..: 
  Rat   269 FPPNSTVYITGFGALYYGGESQNELREARVQIISNDVCKQRHVYGN--EIKRGMFCAGFLEGIYD 331

  Fly   212 -CRSNSGSPLTA--DFTYGVKNITVQVGLVSYGSELC---SPTSVYTDVVAFKDWI 261
             ||.:||.||..  |     |:....:|:||:|.. |   :...|||.|..::.||
  Rat   332 ACRGDSGGPLVVRDD-----KDTWYLIGIVSWGDN-CGQKNKPGVYTQVTYYRRWI 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 67/240 (28%)
Tryp_SPc 46..261 CDD:214473 65/238 (27%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Tmprss11aXP_038948511.1 SEA 35..133 CDD:396113
Tryp_SPc 156..384 CDD:238113 69/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.