DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and ST14

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens


Alignment Length:293 Identity:71/293 - (24%)
Similarity:118/293 - (40%) Gaps:58/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIGLVLCQGLAQLLDKK-CHDPKTSENI-----NFNH-----GATETA----PWMASIYKNNQ-F 57
            |.||.|.:|..:...|: |.|....::.     :|..     |.|:..    ||..|::...| .
Human   575 LNGLCLSKGNPECDGKEDCSDGSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGH 639

  Fly    58 ICDGTLVHKLFVLTAASCISKD--------SQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSN 114
            ||..:|:...::::||.|...|        :|.....|:::|.:.::.  ..::..:...:.|..
Human   640 ICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAP--GVQERRLKRIISHPF 702

  Fly   115 FRPNNGVNDIGLLRLYGEVTHYAHIRPICI-ILDHVVKSAPFERFEGFGWQQQGTEAS-----SQ 173
            |.......||.||.|.....:.:.:||||: ...||..:.......|:|..|.|...:     .:
Human   703 FNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGE 767

  Fly   174 VR---QTVYLSQKKPFECHRNGQLLP--INEGQFCAG--NRDRSFCRSNSGSPLTADFTYGVKNI 231
            :|   ||.         |.   .|||  |.....|.|  :.....|:.:||.||::....|   .
Human   768 IRVINQTT---------CE---NLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADG---R 817

  Fly   232 TVQVGLVSYGSELCSPTS---VYTDVVAFKDWI 261
            ..|.|:||:| :.|:..:   |||.:..|:|||
Human   818 IFQAGVVSWG-DGCAQRNKPGVYTRLPLFRDWI 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 60/241 (25%)
Tryp_SPc 46..261 CDD:214473 58/239 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>171 CDD:307516
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060 8/26 (31%)
Tryp_SPc 615..852 CDD:238113 62/253 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.