DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and c1s

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_002941253.2 Gene:c1s / 613055 XenbaseID:XB-GENE-995410 Length:691 Species:Xenopus tropicalis


Alignment Length:263 Identity:65/263 - (24%)
Similarity:106/263 - (40%) Gaps:59/263 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYKNNQF----ICDGTLVHKLFVLTAASCISKDSQLY-VLFGMYNQYRDASQFFNN---- 101
            |||.      ||    :..|:|:...:|||||..::|  ::: .:||      ...:||.|    
 Frog   449 PWMI------QFTDIELGGGSLISDRWVLTAAHVVNK--KIFPTMFG------GVMKFFPNTNLQ 499

  Fly   102 ---EQYGVAVALQHSNFRPN-------NGVNDIGLLRLYGEVTHYAHIRPICI-------ILDHV 149
               ::......:.|..::.|       |..|||.|::|..:|...:.|.|||:       :::.|
 Frog   500 SQEKRLQAKKIIIHPLYQDNEDTEGQSNFDNDIALVQLTKKVKLGSCISPICLPRRGLAPVVNEV 564

  Fly   150 VKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHR----NGQLLPINEGQFCAGNR-DR 209
            ...|        ||.:.....|:...|...:|.....:|.:    .|...|   ...|||:. .:
 Frog   565 ATIA--------GWGKTEKRESAVNLQFASISLSSMDKCKKATGGKGYFTP---NMLCAGSDVGK 618

  Fly   210 SFCRSNSGSPLTADFTYGVKNITV-QVGLVSYGSELCSPTSVYTDVVAFKDWIYNTVRNFETKGD 273
            ..|..:||.||.  ||....:..: ..|:||:|...|....:||.|..:.|||..|:...|.:..
 Frog   619 DSCNGDSGGPLM--FTDPQDSSKMYMAGIVSWGPRDCGTYGLYTKVDNYLDWIEETIAAVEREEQ 681

  Fly   274 QVV 276
            :.|
 Frog   682 EEV 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 62/249 (25%)
Tryp_SPc 46..261 CDD:214473 60/246 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
c1sXP_002941253.2 CUB 21..131 CDD:238001
FXa_inhibition 145..173 CDD:405372
CUB 177..288 CDD:238001
PHA02927 301..>436 CDD:222943
Tryp_SPc 436..669 CDD:214473 60/246 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.