DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG34436

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:266 Identity:89/266 - (33%)
Similarity:139/266 - (52%) Gaps:20/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LALIGLVLC-QGLAQLLDKKCHD-PKTSENINFNHGATETAPWMASIYKNNQFICDGTLVHKLFV 69
            ||::..:|. ||.|||||:.|.: .:.|.:|.|:.      ||||.:...|: .|.|.|:||.||
  Fly     7 LAVLSWMLANQGSAQLLDQNCAEVSRLSNDIIFSR------PWMALVLLPNK-TCSGALIHKYFV 64

  Fly    70 LTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVT 134
            :|:|||:....:..|..|..:..::....::::.|.|..|..|..:..:|..:||.||.|..:|.
  Fly    65 ITSASCVFNQERAIVRLGQLSIKQEHIVSYSSDDYHVQSAYIHRFYEKSNFEHDIALLELQNDVL 129

  Fly   135 HYAHIRPICIILDHV-VKSAPFERFEGFGW--QQQGTEASSQVRQTVYLSQKKPFECHRNGQLLP 196
            :.|||||||:.||.. :.:..|:|:|.|.|  .::....:::..:..::||.|   |....:|.|
  Fly   130 YKAHIRPICLWLDKSDIDTQMFKRYETFRWGIDEKYILPAAKTSKIKHISQVK---CENAFKLYP 191

  Fly   197 INEGQFCAGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPTSVYTDVVAFKDWI 261
            .| ...|||.:::|.| ..:||||.....|..|......|:.|||.   |.|.:||||..:.|||
  Fly   192 QN-SHICAGYKNKSKC-VETGSPLFKKIRYYTKIRYTLFGIQSYGE---SRTCLYTDVTKYIDWI 251

  Fly   262 YNTVRN 267
            ...::|
  Fly   252 MGVIQN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 74/220 (34%)
Tryp_SPc 46..261 CDD:214473 72/217 (33%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 73/226 (32%)
Tryp_SPc 40..251 CDD:214473 72/225 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.