DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG34437

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster


Alignment Length:269 Identity:78/269 - (28%)
Similarity:114/269 - (42%) Gaps:35/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIGLVLC-QGLAQLLDKKCHDPKTSENINFNHGATETAPWMASI---YKNNQFICDGTLVHKLFV 69
            |..|||. ||.|..||.:|.:.|..:::      .:..||||.|   .||    |.|||::|.:|
  Fly     9 LFTLVLAHQGSAYFLDFECVNHKPHQDV------FKETPWMAFIASPTKN----CSGTLINKQYV 63

  Fly    70 LTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQY---GVAVALQHSNFRPNNGVNDIGLLRLYG 131
            :|.|||:...|:..|..|.::....     |..:|   .|.....|..:......:||.||.|..
  Fly    64 ITTASCVFDQSESTVFLGRFDNIPQ-----NRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDD 123

  Fly   132 EVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLP 196
            .||....|:||||.|..:..   ....|...|.........::.....|..||   | |:...:.
  Fly   124 PVTFKMSIQPICIWLGEITN---LNHLESNRWGLSEKMIFQRINTVKILKIKK---C-RDSFGIT 181

  Fly   197 INEGQFCAGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYG-SELCSPTSVYTDVVAFKDW 260
            :.:.|.|||.::.:.| :.:||.|.....|..|.....:|:.||| ||.|    :|..:..:.||
  Fly   182 LKKSQICAGFQNGNIC-TETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC----IYNKIAHYIDW 241

  Fly   261 IYNTVRNFE 269
            |...|.|.:
  Fly   242 IVGVVLNVD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 65/224 (29%)
Tryp_SPc 46..261 CDD:214473 63/221 (29%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 63/223 (28%)
Tryp_SPc 39..242 CDD:304450 63/223 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.