DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and AgaP_AGAP006673

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_001688952.1 Gene:AgaP_AGAP006673 / 5667010 VectorBaseID:AGAP006673 Length:307 Species:Anopheles gambiae


Alignment Length:309 Identity:76/309 - (24%)
Similarity:118/309 - (38%) Gaps:60/309 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRVLSLALIGLVLCQGLAQ-LLDKKCHDPKTSENI-------------------------NFNH 39
            |..|.:.||:||:.....|: |||   .||...::|                         ...:
Mosquito     1 MKLVAAFALVGLLATLASARSLLD---IDPARVKSIEEYDRYWRRLPAELQYLRTVEQPTRRITN 62

  Fly    40 GATETA---PWMASIYK----NNQFICDGTLVHKLFVLTAASCISKDSQLYVLFG-MYNQYRDAS 96
            |...||   |:.|.:|.    ....:|.||::...:|||||.|::.|....|..| ::....|.:
Mosquito    63 GQLATAGQFPYQAVVYSEAGDGYYSLCGGTILTTTYVLTAAHCVTDDFDRAVTGGIVFLGATDRT 127

  Fly    97 QFFNNEQ---YGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERF 158
            .|.:.:|   :|.|....|..:...:..|||..:||........:::  .|.|..:..:..|..|
Mosquito   128 VFQSTQQRMSFGNAGIRVHPQYNSTSIRNDIATVRLDTAAIFNTYVK--AIDLPALSDARQFGGF 190

  Fly   159 E----GFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLPINEGQFCA---GNRDRSFCRSNS 216
            |    |||.......|:|.|...|........:|:.......:.....|.   |.  ||.|..:|
Mosquito   191 EGTASGFGRTADTVPAASNVLMFVRNPVMTNAQCNAYWSTAVVQAQNVCLDPYGG--RSACHGDS 253

  Fly   217 GSPLTADFTYGVKNITVQVGLVSY----GSELCSPTSVYTDVVAFKDWI 261
            |.||.....    ..::|||:.|:    |....:| ||:..|..|:|:|
Mosquito   254 GGPLAVQDA----GRSLQVGIASFVSANGCTSGAP-SVWVRVSYFRDFI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 60/235 (26%)
Tryp_SPc 46..261 CDD:214473 59/233 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
AgaP_AGAP006673XP_001688952.1 Tryp_SPc 59..297 CDD:214473 62/246 (25%)
Tryp_SPc 60..300 CDD:238113 63/247 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.