DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and TMPRSS4

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_005271670.1 Gene:TMPRSS4 / 56649 HGNCID:11878 Length:494 Species:Homo sapiens


Alignment Length:365 Identity:87/365 - (23%)
Similarity:144/365 - (39%) Gaps:89/365 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KTSENINFNHGATETAPWMASIYKNNQFICDGTLVHKLFVLTAASCISKDSQLY---VLFGMYNQ 91
            ||...:.....:.::.||..||..:.|.:|.|:::...:|||||.|..|.:.::   |..|    
Human   201 KTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAG---- 261

  Fly    92 YRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICI-ILDHVVKSAPF 155
             .|....|.:......:.::.:...|.:  |||.|::|...:|....:||||: ..|..:..|..
Human   262 -SDKLGSFPSLAVAKIIIIEFNPMYPKD--NDIALMKLQFPLTFSGTVRPICLPFFDEELTPATP 323

  Fly   156 ERFEGFGWQQQG--------TEASSQVRQTVYLSQKKPFECHRNGQLLPINEGQFCAGNRDRSF- 211
            ....|:|:.:|.        .:||.||..:...:....::    |:   :.|...|||..:... 
Human   324 LWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQ----GE---VTEKMMCAGIPEGGVD 381

  Fly   212 -CRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPTS--VYTDVVAFKDWIYNTVRNFETKGD 273
             |:.:||.||    .|......| ||:||:|.....|::  |||.|.|:.:||||..:      |
Human   382 TCQGDSGGPL----MYQSDQWHV-VGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWK------D 435

  Fly   274 QVVYEECRSNWAEDVLVRLWEVSLHQNTFSGVLITNRFVLTVASAFPNIPLVMKVETKYLKSFDV 338
            :.:...|.|                  ..:|::|..          |.:||:      .|:|   
Human   436 RTIQRSCNS------------------PGTGLVIQQ----------PAVPLM------ELRS--- 463

  Fly   339 ESIHTHPRFTHSSMDNNIALLKLAHDVPNSDLVKPICIVP 378
             :.||| |.|     ..:..|..    |....:.|:|..|
Human   464 -ARHTH-RLT-----TCVCFLSF----PALQPLSPLCPFP 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 64/233 (27%)
Tryp_SPc 46..261 CDD:214473 61/230 (27%)
Tryp_SPc 293..484 CDD:304450 17/86 (20%)
Tryp_SPc 293..481 CDD:214473 17/86 (20%)
TMPRSS4XP_005271670.1 LDLa 58..92 CDD:238060
SRCR_2 108..197 CDD:295335
Tryp_SPc 204..429 CDD:214473 61/243 (25%)
Tryp_SPc 205..432 CDD:238113 64/245 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.