DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and PROC

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_024308770.1 Gene:PROC / 5624 HGNCID:9451 Length:576 Species:Homo sapiens


Alignment Length:279 Identity:72/279 - (25%)
Similarity:112/279 - (40%) Gaps:48/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DPKTSENINFNHGATETAPWMASIY-KNNQFICDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQ 91
            ||:..:......|   .:||...:. ...:..|...|:|..:|||||.|:.:..:|.|..|.|:.
Human   324 DPRLIDGKMTRRG---DSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDL 385

  Fly    92 YR--------DASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICI---- 144
            .|        |..:.|           .|.|:..:...|||.||.|....|....|.|||:    
Human   386 RRWEKWELDLDIKEVF-----------VHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSG 439

  Fly   145 ILDHVVKSAPFERF-EGFGWQQQGTEASSQVRQTVYLSQKKPFECHRN-GQLLP--INEGQFCAG 205
            :.:..:..|..|.. .|:|:.....:.:.:.|..|....|.|...|.. .:::.  ::|...|||
Human   440 LAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAG 504

  Fly   206 --NRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGS--ELCSPTSVYTDVVAFKDWIYNTVR 266
              ...:..|..:||.|:.|.| :|...:   |||||:|.  .|.....|||.|..:.|||:..:|
Human   505 ILGDRQDACEGDSGGPMVASF-HGTWFL---VGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIR 565

  Fly   267 NFETKGDQVVYEECRSNWA 285
            :.|..         :.:||
Human   566 DKEAP---------QKSWA 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 65/238 (27%)
Tryp_SPc 46..261 CDD:214473 63/235 (27%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
PROCXP_024308770.1 GLA 117..168 CDD:214503
EGF_CA 182..213 CDD:238011
FXa_inhibition 255..290 CDD:317114
Tryp_SPc 328..563 CDD:238113 66/252 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.