DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and PLAU

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens


Alignment Length:297 Identity:71/297 - (23%)
Similarity:116/297 - (39%) Gaps:72/297 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QLLDKKC--HD------PKT-SENINFNHG----------------ATETAPWMASIYKNNQ--- 56
            :||.::|  ||      |.: .|.:.|..|                ..|..||.|:||:.::   
Human   140 KLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGS 204

  Fly    57 --FICDGTLVHKLFVLTAASCI----SKDSQLYVLFGMYNQYRDASQFFNNEQ----YGVAVALQ 111
              ::|.|:|:...:|::|..|.    .|:.        |..|...|:..:|.|    :.|...:.
Human   205 VTYVCGGSLISPCWVISATHCFIDYPKKED--------YIVYLGRSRLNSNTQGEMKFEVENLIL 261

  Fly   112 HSNFRPNNGV--NDIGLLRLYGEVTHYAH----IRPICIILDHVVKSAPFE---RFEGFGWQQQG 167
            |.::..:...  |||.||::..:....|.    |:.||  |..:.....|.   ...||| ::..
Human   262 HKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIC--LPSMYNDPQFGTSCEITGFG-KENS 323

  Fly   168 TE--ASSQVRQTV--YLSQKKPFECHRNGQLLPINEGQFCAGNRD--RSFCRSNSGSPLTADFTY 226
            |:  ...|::.||  .:|.::..:.|..|.  .:.....||.:..  ...|:.:||.||.... .
Human   324 TDYLYPEQLKMTVVKLISHRECQQPHYYGS--EVTTKMLCAADPQWKTDSCQGDSGGPLVCSL-Q 385

  Fly   227 GVKNITVQVGLVSY--GSELCSPTSVYTDVVAFKDWI 261
            |...:|   |:||:  |..|.....|||.|..|..||
Human   386 GRMTLT---GIVSWGRGCALKDKPGVYTRVSHFLPWI 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 61/246 (25%)
Tryp_SPc 46..261 CDD:214473 59/244 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57
KR 67..152 CDD:238056 5/11 (45%)
Connecting peptide 152..177 4/24 (17%)
Tryp_SPc 179..422 CDD:238113 62/258 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.