DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG11313

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:253 Identity:73/253 - (28%)
Similarity:114/253 - (45%) Gaps:36/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TETAPWMASI-YKNN-----QFICDGTLVHKLFVLTAASCISKDS---------QLYVLFGMYNQ 91
            ||.| ||..: |:.:     :..|.|:|::..:|:|||.|:|..:         ::.|..|.:|.
  Fly   125 TEFA-WMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNT 188

  Fly    92 YRDASQFFNNE------QYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVV 150
             .......|..      |..|.....|.:|......|||.|:||..||.:...|||:|  |...|
  Fly   189 -SAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVC--LPSTV 250

  Fly   151 KSAPFERFEGF---GWQQQGTEASSQVRQTVYLSQKKPFECHRN-GQLLPINEGQFCAGNRDR-S 210
            ....::..:.|   ||.:..|..||.|:..:.::..:|..|.|. ..::.:.:...||..|.| .
  Fly   251 GLQNWQSGQAFTVAGWGRTLTSESSPVKMKLRVTYVEPGLCRRKYASIVVLGDSHLCAEGRSRGD 315

  Fly   211 FCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSP--TSVYTDVVAFKDWIYNTVR 266
            .|..:||.||.| |..||   .|..|:||:|....|.  .:|||:|::::.||...:|
  Fly   316 SCDGDSGGPLMA-FHEGV---WVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQNIR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 69/245 (28%)
Tryp_SPc 46..261 CDD:214473 67/242 (28%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 72/249 (29%)
Tryp_SPc 116..364 CDD:214473 70/246 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.