DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:286 Identity:66/286 - (23%)
Similarity:110/286 - (38%) Gaps:61/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LALIGLVLCQGLA------QLLDKKCHDPKTSENINFNHGATE-TAPWMASIY--KNNQFICDGT 62
            |..:.|.:....|      :|:.....|.|....|...:.|.| ..|::..:.  .|..:.|.|:
  Fly     4 LVFLALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGS 68

  Fly    63 LVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQY----GVAVALQHSNFRPNNGVND 123
            ::...:|||||.|.:..|.:.:.:|        :...|..||    |....:||.::...|..||
  Fly    69 IIGNTWVLTAAHCTNGASGVTINYG--------ASLRNQPQYTHWVGSGNFVQHHHYNSGNLHND 125

  Fly   124 IGLLRLYGEVTHYAHIRPICIILD--HVVKSAPF----ERFEGF--------GWQQQGTEASSQV 174
            |.|:|.       .|:       |  |:|.....    :|::.:        ||  .||...|.:
  Fly   126 ISLIRT-------PHV-------DFWHLVNKVELPSYNDRYQDYAGWWAVASGW--GGTYDGSPL 174

  Fly   175 ---RQTVYLSQKKPFECHRNGQLLPINEGQFCAG-NRDRSFCRSNSGSPLTADFTYGVKNITVQV 235
               .|.|.:......:|.|...|   ::...|.. |..:|.|..:||.||...  .|.:.:.|..
  Fly   175 PDWLQAVDVQIMSQSDCSRTWSL---HDNMICINTNGGKSTCGGDSGGPLVTH--EGNRLVGVTS 234

  Fly   236 GLVSYGSELCSPTSVYTDVVAFKDWI 261
            .:.|.|.:..:| :|::.|..:.|||
  Fly   235 FVSSAGCQSGAP-AVFSRVTGYLDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 57/240 (24%)
Tryp_SPc 46..261 CDD:214473 55/238 (23%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 58/251 (23%)
Tryp_SPc 38..262 CDD:238113 60/252 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435980
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.