DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG9733

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:250 Identity:67/250 - (26%)
Similarity:114/250 - (45%) Gaps:35/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASI-YKNN-----QFICDGTLVHKLFVLTAASCISK--DSQLYVLFGMYNQYRDASQFFN-- 100
            |||..: |:..     ...|.|:|:::.:|||||.|::.  :.::..|..:.....|.....:  
  Fly   174 PWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRLGEHDTRTAVDCP 238

  Fly   101 ---------NEQYGVAVALQHSNF--RPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAP 154
                     .::.|......|..:  :.:|.|:||||:|:...|.:..:|:|||:.....::|..
  Fly   239 PGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPICLPSSVGLESRQ 303

  Fly   155 F-ERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLPIN--EGQFCAGNRDR-SFCRSN 215
            . ::|...||.:....|.|.|:|.|.::...|.:|.:....:.:|  ..|.|||.:.| ..|..:
  Fly   304 SGQQFTVAGWGRTLKMARSAVKQKVTVNYVDPAKCRQRFSQIKVNLEPTQLCAGGQFRKDSCDGD 368

  Fly   216 SGSPLT--ADFTYGVKNITVQVGLVSYGSE--LCSPTSVYTDVVAFKDWIYNTVR 266
            ||.||.  .|.::      |..|:||:|.:  |.....|||:|.|:..||...||
  Fly   369 SGGPLMRFRDESW------VLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNVR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 65/246 (26%)
Tryp_SPc 46..261 CDD:214473 63/243 (26%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 63/243 (26%)
Tryp_SPc 162..415 CDD:238113 65/246 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.