DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG9737

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:283 Identity:73/283 - (25%)
Similarity:115/283 - (40%) Gaps:64/283 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMA-SIYKNNQFICDGTLVHKLFVLTAASCIS----KDSQ--LYVLFGMYNQYRDAS-----QF 98
            ||:| .:|.:|.:.|.|.|:....:||||.|:.    :|.|  .:|..|.:|...:..     .:
  Fly   162 PWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNY 226

  Fly    99 FNNEQYGVAVALQHSNFRP------NNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFER 157
            .:.....:.:|.:..:..|      |...|||.::||...|:....:.|||:    ..||.|...
  Fly   227 LSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICL----PNKSEPLTL 287

  Fly   158 FEG-----FGWQQQGTEASSQ----VRQTVYLSQKKPFECHRNGQLLPINEG--------QFCAG 205
            .||     .||.:  |:..::    :...:.|..:.|:..:.|  ...|.||        |.|||
  Fly   288 AEGQMFSVSGWGR--TDLFNKYFINIHSPIKLKLRIPYVSNEN--CTKILEGFGVRLGPKQICAG 348

  Fly   206 NR-DRSFCRSNSGSPLTADFTYGVKNIT--VQVGLVSYGSELC---SPTSVYTDVVAFKDWIYNT 264
            .. .:..|..:||.||    .|..:..:  |..|:||||...|   ...:|||:|..:.|||   
  Fly   349 GEFAKDTCAGDSGGPL----MYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWI--- 406

  Fly   265 VRNFETKGDQVVYEECRSNWAED 287
                    |.||.:..:|...:|
  Fly   407 --------DSVVQQRKKSQQTQD 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 68/258 (26%)
Tryp_SPc 46..261 CDD:214473 66/255 (26%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 66/255 (26%)
Tryp_SPc 150..409 CDD:238113 69/269 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.