DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:224 Identity:56/224 - (25%)
Similarity:95/224 - (42%) Gaps:40/224 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NNQFICDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPN 118
            |..:.|.|:::...:|||||.|.:..|.:.:.:|.  ..|...|:  ....|....:||.::...
  Fly    58 NGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGA--SIRTQPQY--THWVGSGDIIQHHHYNSG 118

  Fly   119 NGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEGF--------GWQQQGTEASSQV- 174
            |..|||.|:|.       .|: ....:::.|...:..:|::.:        ||  .||...|.: 
  Fly   119 NLHNDISLIRT-------PHV-DFWSLVNKVELPSYNDRYQDYAGWWAVASGW--GGTYDGSPLP 173

  Fly   175 --RQTVYLSQKKPFECHRNGQLLPINEGQFCAGNRD--RSFCRSNSGSPLTADFTYGVKNITVQV 235
              .|:|.:......:|.|...|   ::...|. |.|  :|.|..:||.||.   |:....:   |
  Fly   174 DWLQSVDVQIISQSDCSRTWSL---HDNMICI-NTDGGKSTCGGDSGGPLV---THDGNRL---V 228

  Fly   236 GLVSYGSEL-C--SPTSVYTDVVAFKDWI 261
            |:.|:||.. |  ...:|::.|..:.|||
  Fly   229 GVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 56/224 (25%)
Tryp_SPc 46..261 CDD:214473 54/222 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 56/224 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436079
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.