DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG11842

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:235 Identity:65/235 - (27%)
Similarity:88/235 - (37%) Gaps:51/235 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QFICDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQYR--DASQFFNN-----EQYGVAVALQHS 113
            ::.|.|||:....|||||.|      .|...|..|..|  |.....||     |.:.|.....|.
  Fly   100 EWFCGGTLISDRHVLTAAHC------HYSPQGSVNIARLGDLEFDTNNDDADPEDFDVKDFTAHP 158

  Fly   114 NFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFE------RFEGFGWQQ----QGT 168
            .|......|||.::||...||...:..|.|:         ||:      .|...||.|    ..|
  Fly   159 EFSYPAIYNDISVVRLSRPVTFNDYKHPACL---------PFDDGRLGTSFIAIGWGQLEIVPRT 214

  Fly   169 EASSQVRQTVY-LSQKKPFECHRNGQLLPINEG-----QFCAG-NRDRSFCRSNSGSPLT---AD 223
            |.....:..:| ...:......||.:|   .||     |.|.| |..:..|..:||.|:.   .|
  Fly   215 ENKKLQKVKLYNYGTRCRITADRNDEL---PEGYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMD 276

  Fly   224 F--TYGVKNITVQVGLVSYGSELCSPTSVYTDVVAFKDWI 261
            :  .|.|..|| .:|:.....:|   .::||.|..:.|||
  Fly   277 YPCMYHVMGIT-SIGVACDTPDL---PAMYTRVHFYLDWI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 65/235 (28%)
Tryp_SPc 46..261 CDD:214473 63/233 (27%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 65/235 (28%)
Tryp_SPc 73..312 CDD:214473 63/233 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.