DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG11841

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:272 Identity:75/272 - (27%)
Similarity:106/272 - (38%) Gaps:56/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PKTSENINFNHGA-----------TETAPWMASI---YKNNQ--FICDGTLVHKLFVLTAASCIS 77
            |.|.|.::..||:           .:..|:.|.:   ..||:  :.|.|||:....|||||.|..
  Fly    56 PITYETVDSCHGSRPLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFF 120

  Fly    78 KDSQLYVLFGMYNQYRDASQFFNN-------EQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTH 135
            .:      .|..|..|.....|:.       |.:||.....|..|......||||:::|..||..
  Fly   121 SE------HGEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKF 179

  Fly   136 YAHIRPICIILDHVVKSAPFERFEGFGW-QQQGTEASSQVRQTVYLSQKKPFEC----HRNGQLL 195
            ..:..|.|:..|   .....|.|...|| |::..:..|:....|.|...|. .|    ..|.: |
  Fly   180 NRYKHPACLPFD---DGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKD-RCVSSVDANDE-L 239

  Fly   196 PIN---EGQFCAGNRD-RSFCRSNSGSPLTA---DFT--YGVKNITVQVGLVSYGSELCSP--TS 249
            |..   :.|.|.|:|| :..|..:||.|:.|   |..  |.|      :|:.|.|....:|  .|
  Fly   240 PNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHV------MGITSAGITCSTPDIPS 298

  Fly   250 VYTDVVAFKDWI 261
            .||.|..|.:||
  Fly   299 AYTRVHYFLNWI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 70/244 (29%)
Tryp_SPc 46..261 CDD:214473 68/242 (28%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 70/256 (27%)
Tryp_SPc 72..310 CDD:214473 68/254 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437612
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.