DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG4815

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:179 Identity:38/179 - (21%)
Similarity:74/179 - (41%) Gaps:19/179 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IYKNNQFICDGTLVHKLFVLTAASCIS--KDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHS 113
            ::...:.:|..||:....:||||.|..  ..|:.:|:.|...::......||..:. :.|.: |.
  Fly    53 LFNGRKLVCSATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHGNNFNKNKL-IRVQI-HP 115

  Fly   114 NFRPNNGVNDIGLLRL-YGEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQGTEASSQVRQT 177
            .:.....:.|:.:.:. |...:.|.....:|..:.|     |.::....||..:| ....:.|:.
  Fly   116 KYAKMKFIADVAVAKTKYPLRSKYIGYAQLCRSVLH-----PRDKLIAAGWGFEG-GVWDESRKK 174

  Fly   178 VYLSQK----KPFECHRN-GQLLPINEGQFCAG-NRDRSFCRSNSGSPL 220
            .:.|.|    ...:|.:. .:.:|.|  ..||| ..:::.|..:||.||
  Fly   175 TFRSMKVGIVSKRDCEKQLDRKMPPN--IICAGAYNNKTLCFGDSGGPL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 38/179 (21%)
Tryp_SPc 46..261 CDD:214473 38/179 (21%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 38/179 (21%)
Trypsin 49..256 CDD:278516 38/179 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436640
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.