DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG5909

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:272 Identity:72/272 - (26%)
Similarity:122/272 - (44%) Gaps:32/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QGLAQLLDKKCH-----DPKTSENINFNHGATETAPWMASI-YKNNQ---FICDGTLVHKLFVLT 71
            ||| |||:...:     :||.|.......|   ..||:|.: ||.|.   |.|.|:|:.:..:||
  Fly   111 QGL-QLLNSVTNCGNKGNPKVSGGKTARPG---DFPWVALLKYKINDPRPFRCGGSLISERHILT 171

  Fly    72 AASC-ISKDSQLYVLFGMYN-QYRDASQFFNN---------EQYGVAVALQHSNFRPNNGVNDIG 125
            ||.| |.:...:.|..|.:: :..:...:...         |:||:.....|.|:......:|:.
  Fly   172 AAHCIIDQPEVIAVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVA 236

  Fly   126 LLRLYGEVTHYAHIRPICIILDHVVKSAPFER-FEGFGWQQQGTEASSQVRQTVYLSQKKPFECH 189
            :::|...|...:||:|:|:.:|...:...|:: |...||.....|..:...|...:::|...||.
  Fly   237 IIKLDRVVKEKSHIKPVCLPIDQKSQELDFDQSFFVAGWGGTEKETVATKLQQALITRKSLNECR 301

  Fly   190 RNGQLLPINEGQFCA-GNRDRSFCRSNSGSPLTADFTYGVKNI--TVQVGLVSYGSELC--SPTS 249
            :......:::...|| |...:..|:.:||.|:.  |.:..||.  .||.|:||:|..||  :...
  Fly   302 QYYNKGEVSDNHICATGTGIKHTCQGDSGGPVF--FKHRFKNTYRVVQYGVVSFGGRLCGQNQPG 364

  Fly   250 VYTDVVAFKDWI 261
            |:..|:....||
  Fly   365 VFASVIDMLPWI 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 62/237 (26%)
Tryp_SPc 46..261 CDD:214473 60/235 (26%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 63/251 (25%)
Tryp_SPc 132..379 CDD:238113 63/250 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.