DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and SPE

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:263 Identity:71/263 - (26%)
Similarity:114/263 - (43%) Gaps:46/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GATETA----PWMASI-YK-----NNQFICDGTLVHKLFVLTAASCISK---DSQLYVL----FG 87
            |.|.|.    |||..: ||     ...|.|.|.|::..:||||..|::.   |....||    .|
  Fly   137 GGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLG 201

  Fly    88 MYNQYR--DASQFFNNEQ--------YGVAVALQHSNFRPN--NGVNDIGLLRLYGEVTHYAHIR 140
            .::...  |.:...|.::        ..|...:.|..:.||  :..|||.|:||...|::..::|
  Fly   202 EWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVR 266

  Fly   141 PICIILDHVVKSAPFERFEGFGWQQQG---TE--ASSQVRQTVYLSQKKPFECHR--NGQLLPIN 198
            |||:..|.:|::    .|..:|....|   ||  ..|.::..:.::......|..  :...:.::
  Fly   267 PICLPTDGLVQN----NFVDYGMDVAGWGLTENMQPSAIKLKITVNVWNLTSCQEKYSSFKVKLD 327

  Fly   199 EGQFCAGNR-DRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCS----PTSVYTDVVAFK 258
            :.|.|||.: ....|..:||.||....:.|.:::....|:.|||::.|.    | .|||...||.
  Fly   328 DSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWP-GVYTRTGAFI 391

  Fly   259 DWI 261
            |||
  Fly   392 DWI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 68/253 (27%)
Tryp_SPc 46..261 CDD:214473 66/251 (26%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 71/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463661
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.